CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Seaweed Onigiri with Pickled Veg

Hand-formed sushi rice balls wrapped in crispy nori, filled with umami-rich pickled plum or kelp, served with bright pickled vegetables. A TikTok-worthy Japanese snack that doubles as dinner.

Total time
20 min
Servings
2
Calories
280
Protein
5g
Crispy Seaweed Onigiri with Pickled Veg
casualfreshjapanesevegetarianvegancrispytenderweeknight

Ingredients

  • 2 cups sushi rice (cooked & cooled)
  • 4 sheets nori sheets (dried seaweed)
  • 4 pieces umeboshi (pickled plum) or takuwan (pickled radish)
  • 1 tbsp rice vinegar
  • ½ tsp granulated sugar
  • 1 whole cucumber (sliced into thin matchsticks)
  • 1 cup daikon radish (sliced into thin matchsticks)
  • ¼ tsp salt

Instructions

  1. 1

    Toss cooled rice with rice vinegar and sugar until the grains are coated and glossy.

  2. 2

    Place cucumber and daikon matchsticks in a small bowl, sprinkle with salt, and let sit for 2 minutes to soften slightly.

  3. 3

    Wet your hands lightly with water to prevent sticking. Scoop 1/4 cup rice into your palm and flatten it into a small disk.

  4. 4

    Place one piece of umeboshi or takuwan in the center, then fold rice around it until sealed into a ball or triangle.

  5. 5

    Repeat with remaining rice and fillings to form 4 onigiri total.

  6. 6

    Wrap each onigiri tightly with a nori sheet, overlapping the edges to seal. Serve with pickled vegetables on the side.

Tools you’ll need

  • small mixing bowl
  • small serving bowl
  • your hands (dampened with water)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.