Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Seaweed Onigiri with Pickled Veg

Hand-formed sushi rice balls wrapped in crispy nori, filled with umami-rich pickled plum or kelp, served with bright pickled vegetables. A TikTok-worthy Japanese snack that doubles as dinner.

Total time
20 min
Servings
2
Calories
280
Protein
5g
Crispy Seaweed Onigiri with Pickled Veg
casualfreshjapanesevegetarianvegancrispytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss cooled rice with rice vinegar and sugar until the grains are coated and glossy.

  2. Step 2

    Place cucumber and daikon matchsticks in a small bowl, sprinkle with salt, and let sit for 2 minutes to soften slightly.

  3. Step 3

    Wet your hands lightly with water to prevent sticking. Scoop 1/4 cup rice into your palm and flatten it into a small disk.

  4. Step 4

    Place one piece of umeboshi or takuwan in the center, then fold rice around it until sealed into a ball or triangle.

  5. Step 5

    Repeat with remaining rice and fillings to form 4 onigiri total.

  6. Step 6

    Wrap each onigiri tightly with a nori sheet, overlapping the edges to seal. Serve with pickled vegetables on the side.

Tools you’ll need

  • small mixing bowl
  • small serving bowl
  • your hands (dampened with water)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.