Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shrimp Glass Noodle Salad

Thai yum woon sen with crispy shrimp, tart lime dressing, and tender glass noodles. Ready in 20 minutes — bright, spicy, totally craveable.

Total time
20 min
Servings
2
Calories
285
Protein
28g
Crispy Shrimp Glass Noodle Salad
freshlightthaigluten-freeshrimpcrispytenderchewy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak glass noodles in hot water for 5 minutes until softened, then drain well.

  2. Step 2

    Heat 2 tbsp oil in a skillet over medium-high until shimmering. Pat shrimp dry, add to pan in a single layer.

  3. Step 3

    Cook shrimp without stirring for 2 minutes until pink on one side, then flip and cook 90 seconds more until opaque.

  4. Step 4

    Whisk lime juice, fish sauce, and 1 tbsp water together in a bowl until combined.

  5. Step 5

    Toss noodles, cooked shrimp, red onion, chili, cilantro, and mint in a large bowl with the dressing.

  6. Step 6

    Top with crushed peanuts and serve immediately.

Tools you’ll need

  • medium mixing bowl
  • 12-inch skillet
  • wooden spoon
  • whisk
  • large serving bowl
  • kitchen knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.