Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Shrimp Ukoy

Filipino-style shrimp and sweet potato fritters with a crispy exterior and tender interior. Fried golden in minutes and served with a tangy vinegar dipping sauce.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Crispy Shrimp Ukoy
satisfyingcasualfilipinoshrimpcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, whisk together flour, 1 beaten egg, 0.5 tsp salt, and 0.25 tsp black pepper.

  2. Step 2

    Fold shrimp and julienned sweet potato into the batter until fully coated.

  3. Step 3

    Heat oil in a shallow skillet over medium-high until a wooden spoon submerged sizzles immediately, ~3 minutes.

  4. Step 4

    Scoop batter in 2-tbsp portions into hot oil; fry 3–4 fritters at a time until golden brown, ~2 minutes per side.

  5. Step 5

    Transfer ukoy to a paper-towel-lined plate.

  6. Step 6

    Stir vinegar with 0.25 cup water and 0.5 tsp salt; serve as dipping sauce alongside fritters.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • shallow skillet or frying pan
  • wooden spoon
  • slotted spoon or spider strainer
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.