Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sole Meunière

Paper-thin sole fillets pan-seared until golden, then finished with brown butter and lemon. Elegant, fast, and pure French bistro on a weeknight.

Total time
15 min
Servings
2
Calories
310
Protein
32g
Crispy Sole Meunière
elegantlightfrenchfishcrispytenderflakyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat sole dry with paper towels. Season both sides generously with salt and pepper.

  2. Step 2

    Spread flour on a plate. Dredge each fillet lightly on both sides, shaking off excess.

  3. Step 3

    Heat 2 tbsp butter in a 12-inch skillet over medium-high until foaming, about 90 seconds.

  4. Step 4

    Lay sole in the pan without moving for 2 minutes until the underside is golden, then flip and cook 1 minute more.

  5. Step 5

    Transfer sole to a plate. Add remaining 2 tbsp butter to the skillet, swirling until it turns nutty brown, about 90 seconds.

  6. Step 6

    Squeeze half the lemon over the sole, drizzle with brown butter, and finish with parsley. Serve immediately.

Tools you’ll need

  • 12-inch stainless steel or non-stick skillet
  • paper towels
  • shallow plate
  • tongs or fish spatula
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.