Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sopes with Shredded Beef Tinga

Crispy fried masa cups loaded with tangy chipotle-tomato shredded beef, topped with crema and fresh onion. Authentic Mexican comfort that's ready in 25 minutes.

Total time
25 min
Servings
4
Calories
385
Protein
22g
Crispy Sopes with Shredded Beef Tinga
comfortcasualmexicanbeefcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1/4 inch neutral oil in a large skillet over medium-high until it shimmers, ~2 minutes.

  2. Step 2

    Divide masa into 8 balls and gently press into shallow cups (2 to 3 inches across, thin walls). Fry 2 to 3 minutes per side until edges are golden and crispy.

  3. Step 3

    Remove sopes with a slotted spoon and drain on paper towels, tilting to release excess oil.

  4. Step 4

    Combine shredded beef, diced tomatoes with chiles, minced chipotle, and salt and pepper to taste in a bowl. Stir until warm throughout.

  5. Step 5

    Divide beef mixture among sopes. Top each with a dollop of crema, minced onion, and crumbled cheese. Serve immediately.

Tools you’ll need

  • large skillet or griddle (12-inch)
  • slotted spoon
  • paper towels
  • mixing bowl
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.