Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Sopes with Chipotle Beef Tinga

Homemade crispy masa sopes loaded with smoky chipotle shredded beef, topped with sour cream and queso fresco. TikTok-easy weeknight meal that tastes like a taqueria.

Total time
28 min
Servings
4
Calories
420
Protein
28g
Crispy Sopes with Chipotle Beef Tinga
comfortcasualmexicanbeefcrispytendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix masa harina with 0.75 cup warm broth and a pinch of salt until a thick dough forms, about 2 minutes.

  2. Step 2

    Divide dough into 4 balls. Flatten each into a 3-inch disk on plastic wrap, then use your thumb to pinch up the edges into a shallow bowl shape.

  3. Step 3

    Heat 2 tbsp oil in a large skillet over medium-high. Fry sopes 3 minutes per side until golden and crispy. Transfer to a plate.

  4. Step 4

    In the same skillet, brown ground beef over medium-high, breaking it up, until no pink remains, about 5 minutes.

  5. Step 5

    Blend chipotles with 0.25 cup water and 1 tbsp adobo sauce until smooth. Pour into beef, add diced onion, and simmer 2 minutes until glossy.

  6. Step 6

    Spoon chipotle beef onto each sope. Top with sour cream, queso fresco, and cilantro. Serve immediately.

Tools you’ll need

  • medium mixing bowl
  • plastic wrap
  • 12-inch skillet
  • blender or food processor
  • wooden spoon
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.