Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Taiwanese Chicken Cutlet with Slaw

Pounded chicken breast fried until golden and crunchy, served with a bright vinegary slaw and carrot. Ready in under 15 minutes — the kind of snack that feels way fancier than it is.

Total time
12 min
Servings
2
Calories
420
Protein
34g
Crispy Taiwanese Chicken Cutlet with Slaw
casualsatisfyingtaiwanesechickencrispytendercrunchySalad

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry. Place each breast between plastic wrap and pound to 1/4-inch thickness.

  2. Step 2

    Season chicken generously with salt and pepper. Whisk egg in a shallow bowl; spread flour in another.

  3. Step 3

    Coat each cutlet in flour, shake off excess, dip in egg, then coat in flour again for extra crunch.

  4. Step 4

    Heat 3 tbsp oil in a 12-inch skillet over medium-high until shimmering. Fry cutlets 3 minutes per side until golden brown.

  5. Step 5

    Toss shredded cabbage and sliced carrots with vinegar, salt, and pepper in a bowl.

  6. Step 6

    Plate cutlets alongside the slaw. Serve immediately while chicken is still crackling.

Tools you’ll need

  • 12-inch skillet
  • plastic wrap
  • meat mallet
  • two shallow bowls
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.