Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tasajo with Lime & Chiltepin

Sun-dried beef jerky crisped in a hot skillet with lime, garlic, and optional chiltepin for authentic Oaxacan flavor. A quick, smoky, textural dinner that tastes like street food.

Total time
25 min
Servings
2
Calories
285
Protein
32g
Crispy Tasajo with Lime & Chiltepin
rusticboldmexicanbeefcrispychewyweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tablespoons oil in a large skillet over medium-high until shimmering, about 90 seconds.

  2. Step 2

    Add tasajo strips and cook without stirring until edges brown and crisp, 3–4 minutes.

  3. Step 3

    Flip the strips and crisp the other side another 2–3 minutes until they curl and char slightly.

  4. Step 4

    Push tasajo to the side; add garlic to the empty space and cook 30 seconds until fragrant.

  5. Step 5

    Stir in onion and chiltepin, cooking 2–3 minutes until onion softens and flavors meld.

  6. Step 6

    Squeeze lime juice over everything, toss gently, and serve with avocado and cilantro if desired.

Tools you’ll need

  • large 12-inch skillet
  • cutting board
  • knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.