Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Tempura Tendon with Rice

Golden-fried shrimp and vegetable tempura over steaming white rice, drenched in a sweet-savory dashi sauce. Pure comfort in 25 minutes — no deep fryer required.

Total time
25 min
Servings
2
Calories
420
Protein
18g
Crispy Tempura Tendon with Rice
comfortsatisfyingjapaneseshrimpcrispytenderweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat shrimp dry with paper towels. Mix flour and cold water in a bowl until thick, lumpy batter forms — a few flour streaks are fine.

  2. Step 2

    Heat 0.5 inch neutral oil in a 12-inch skillet over medium-high until a grain of flour sizzles immediately, ~3 minutes. Test with a thermometer — aim for 350°F.

  3. Step 3

    Dip shrimp in batter, then slide into oil. Fry 2–3 minutes per side until golden and crispy outside. Don't move them; flip only once. Transfer to a paper towel–lined plate.

  4. Step 4

    Pour off most oil, leaving 1 tbsp in the skillet. Add soy sauce and mirin, swirling to combine. Warm for 30 seconds until fragrant — this is your tendon sauce.

  5. Step 5

    Divide steamed rice between two bowls. Top each with 4 tempura shrimp and drizzle sauce over everything. Serve immediately while tempura is still crispy.

Tools you’ll need

  • 12-inch skillet with deep sides
  • instant-read thermometer
  • paper towels
  • small mixing bowl
  • slotted spoon or chopsticks
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.