CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Vada in Spicy Rasam Broth

Golden, lentil-flour fritters dunked into a tangy, spicy tamarind broth—ready in under 30 minutes. Served with coconut chutney for dipping and scooping.

Total time
28 min
Servings
2
Calories
320
Protein
8g
Crispy Vada in Spicy Rasam Broth
comfortwholesomeindianvegetarianvegetariancrispyfluffyweeknight

Ingredients

  • 1 cup urad dal flour (or chickpea flour)
  • ½ cup onion, finely minced
  • 1 whole green chili, minced
  • ½ cup water
  • 2 tbsp tamarind paste
  • ½ tsp cumin seeds
  • 1 tsp red chili powder
  • ½ cup coconut chutney (store-bought or homemade)

Instructions

  1. 1

    Mix urad flour, minced onion, green chili, salt, and 0.5 cup water until you have a thick batter that holds together.

  2. 2

    Heat 1.5 inches of neutral oil in a deep skillet or pot to 350°F (a pinch of batter should sizzle immediately).

  3. 3

    Drop 6–8 spoonfuls of batter into the hot oil, using two spoons to release gently. Fry until golden brown on all sides, 5–6 minutes.

  4. 4

    Drain vada on paper towels. Pour off most oil from the pan, leaving about 1 tbsp; toast cumin seeds 30 seconds until fragrant.

  5. 5

    Add 2 cups water, tamarind paste, red chili powder, and salt. Simmer 3–4 minutes until broth is fragrant and slightly reduced.

  6. 6

    Divide vada between bowls, pour hot rasam broth over top, and serve with coconut chutney on the side for dipping.

Tools you’ll need

  • deep skillet or heavy-bottomed pot
  • spoon or slotted spoon
  • thermometer or test spoon
  • paper towels
  • bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.