Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Vada in Spicy Rasam Broth

Golden, lentil-flour fritters dunked into a tangy, spicy tamarind broth—ready in under 30 minutes. Served with coconut chutney for dipping and scooping.

Total time
28 min
Servings
2
Calories
320
Protein
8g
Crispy Vada in Spicy Rasam Broth
comfortwholesomeindianvegetarianvegetariancrispyfluffyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix urad flour, minced onion, green chili, salt, and 0.5 cup water until you have a thick batter that holds together.

  2. Step 2

    Heat 1.5 inches of neutral oil in a deep skillet or pot to 350°F (a pinch of batter should sizzle immediately).

  3. Step 3

    Drop 6–8 spoonfuls of batter into the hot oil, using two spoons to release gently. Fry until golden brown on all sides, 5–6 minutes.

  4. Step 4

    Drain vada on paper towels. Pour off most oil from the pan, leaving about 1 tbsp; toast cumin seeds 30 seconds until fragrant.

  5. Step 5

    Add 2 cups water, tamarind paste, red chili powder, and salt. Simmer 3–4 minutes until broth is fragrant and slightly reduced.

  6. Step 6

    Divide vada between bowls, pour hot rasam broth over top, and serve with coconut chutney on the side for dipping.

Tools you’ll need

  • deep skillet or heavy-bottomed pot
  • spoon or slotted spoon
  • thermometer or test spoon
  • paper towels
  • bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.