Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Minute Crispy Zucchini Parm

Thin-sliced zucchini, pan-fried until golden, layered with marinara and melty mozzarella. Ready in 20 minutes — the weeknight version of the Italian classic.

Total time
20 min
Servings
4
Calories
385
Protein
16g
20-Minute Crispy Zucchini Parm
comfortsatisfyingitalianvegetarianvegetariancrispymeltytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice zucchini lengthwise into 1/4-inch-thick planks. Pat dry with paper towels.

  2. Step 2

    Pour flour into a shallow bowl. Dredge each zucchini slice lightly, shaking off excess.

  3. Step 3

    Heat oil in a large skillet over medium-high until it shimmers, ~60 seconds.

  4. Step 4

    Pan-fry zucchini in batches 2–3 minutes per side until golden brown. Transfer to a plate.

  5. Step 5

    Wipe skillet clean. Spread 1/2 cup marinara on the bottom. Layer half the zucchini, half the mozzarella, half the parmesan, then remaining sauce.

  6. Step 6

    Top with remaining zucchini, mozzarella, and parmesan. Cook over medium 3–4 minutes until cheese melts and edges bubble.

Tools you’ll need

  • chef's knife
  • cutting board
  • paper towels
  • shallow bowl
  • 12-inch skillet
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.