Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Dutch Beef Stamppot Hutspot

Mashed potatoes, carrots, and onions layered with browned ground beef and topped with a crispy fried onion crown. A weeknight version of the Dutch classic.

Total time
28 min
Servings
4
Calories
542
Protein
24g
Dutch Beef Stamppot Hutspot
comfortheartydutchbeefcreamytendercrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes and carrots in salted water until fork-tender, about 12 minutes. Drain and set aside.

  2. Step 2

    While potatoes cook, chop 1.5 onions. Heat oil in a large skillet over medium-high and brown ground beef, breaking it with a spoon, until no pink remains, ~6 minutes.

  3. Step 3

    Add chopped onions and beef broth to the beef. Simmer for 2 minutes until onions soften slightly.

  4. Step 4

    Mash hot potatoes and carrots with butter and a pinch of salt until creamy but still textured. Fold into the beef mixture gently.

  5. Step 5

    Slice remaining half onion into thin rings. Fry in a small skillet with oil over medium-high until golden and crispy, ~4 minutes.

  6. Step 6

    Transfer stamppot to a serving bowl. Top with crispy onions and parsley. Serve hot.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • small skillet (8-inch)
  • wooden spoon
  • colander
  • potato masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.