Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Ebi Mayo Shrimp

Crispy fried shrimp coated in a creamy, tangy Japanese mayo sauce with a hint of sweetness. Ready in under 20 minutes with just a few pantry staples.

Total time
20 min
Servings
2
Calories
420
Protein
22g
Ebi Mayo Shrimp
indulgentsatisfyingjapaneseshrimpcrispytendercreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry with paper towels by gently pressing each shrimp against a towel to remove surface moisture, so they will crisp properly when fried.

  2. Step 2

    Crack the egg into a shallow bowl and beat it with a fork until the white and yolk are fully mixed and uniform in color.

  3. Step 3

    Pour the cornstarch into a separate shallow bowl or small plate.

  4. Step 4

    Mix the Japanese mayonnaise and sweetened condensed milk together in a small bowl, stirring with a spoon until completely smooth and uniform, about 30 seconds, so the sauce is creamy and slightly sweet.

  5. Step 5

    Heat 1 tablespoon of oil in a 12-inch skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 90 seconds.

  6. Step 6

    Take one shrimp, dip it into the beaten egg so it is fully coated, then roll it in the cornstarch until all sides are covered and white.

  7. Step 7

    Place the coated shrimp into the hot oil and repeat with remaining shrimp until the skillet is full but not crowded, working in batches if needed.

  8. Step 8

    Cook the shrimp until the coating turns light golden brown and the shrimp just begins to curl, about 2 to 3 minutes per side, flipping once with tongs.

  9. Step 9

    Transfer the cooked shrimp to a clean plate using tongs.

  10. Step 10

    Repeat steps 6–9 with remaining shrimp, adding another 1 tablespoon of oil if the skillet looks dry.

  11. Step 11

    Pour the mayo mixture into a small bowl and add a pinch of salt and pepper, stirring once to combine.

  12. Step 12

    Arrange the fried shrimp on a serving plate, then drizzle the mayo sauce over the top until the shrimp are lightly coated.

Tools you’ll need

  • 12-inch skillet
  • 3 shallow bowls or plates
  • fork
  • spoon
  • paper towels
  • tongs
  • small serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.