Egg Banjo Sandwich
A runny fried egg on buttered toast with ketchup — the British classic that's crispy toast meets molten yolk. Takes 5 minutes, no fuss.
- Total time
- 5 min
- Servings
- 1
- Calories
- 285
- Protein
- 9g

simplecasualbritisheggscrispycreamyweeknightbreakfast
Ingredients
- 2 slices bread
- 1 large egg
- 1 tbsp butter
- 1 tbsp ketchup
Instructions
- 1
Heat a skillet over medium-high until a drop of water skitters across the surface, about 60 seconds.
- 2
Crack the egg into the pan without stirring. Cook until whites set but the yolk still jiggles when you nudge it, 3–4 minutes.
- 3
Butter both slices of bread while the egg cooks. Spread ketchup over one slice.
- 4
Slide the egg onto the ketchup-side toast, yolk facing up. Top with the other slice, buttered-side down.
- 5
Serve immediately, before the yolk sets.
Tools you’ll need
- skillet
- spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



