Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Egg Banjo Sandwich

A runny fried egg on buttered toast with ketchup — the British classic that's crispy toast meets molten yolk. Takes 5 minutes, no fuss.

Total time
5 min
Servings
1
Calories
285
Protein
9g
Egg Banjo Sandwich
simplecasualbritisheggscrispycreamyweeknightbreakfast

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until a drop of water skitters across the surface, about 60 seconds.

  2. Step 2

    Crack the egg into the pan without stirring. Cook until whites set but the yolk still jiggles when you nudge it, 3–4 minutes.

  3. Step 3

    Butter both slices of bread while the egg cooks. Spread ketchup over one slice.

  4. Step 4

    Slide the egg onto the ketchup-side toast, yolk facing up. Top with the other slice, buttered-side down.

  5. Step 5

    Serve immediately, before the yolk sets.

Tools you’ll need

  • skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.