Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Egg Fried Rice with Crispy Veg

Hot-wok fried rice with scrambled eggs, frozen veggies, and a soy-salt sear — ready in under 10 minutes. Serve with fresh cucumbers, tomatoes, and shredded carrots on the side for crunch.

Total time
10 min
Servings
2
Calories
340
Protein
12g
10-Min Egg Fried Rice with Crispy Veg
quicksatisfyingasianvegetarianeggscrispyfluffyweeknight

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over high heat until it shimmers, about 90 seconds.

  2. Step 2

    Crack eggs into the skillet, scramble with a spatula for 60 seconds until mostly set, then push to the side.

  3. Step 3

    Add frozen vegetables to the empty space, stir constantly for 2 minutes until they start to caramelize.

  4. Step 4

    Pour in rice, breaking up clumps with the spatula, and toss everything together for 3 minutes.

  5. Step 5

    Drizzle soy sauce over the rice, toss for 1 minute until the rice is glossy and heated through.

  6. Step 6

    Plate the fried rice and serve with cucumber slices, cherry tomatoes, shredded carrots, and lettuce on the side.

Tools you’ll need

  • large skillet or wok (12-inch minimum)
  • spatula
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.