CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Min Egg Fried Rice with Crispy Veg

Hot-wok fried rice with scrambled eggs, frozen veggies, and a soy-salt sear — ready in under 10 minutes. Serve with fresh cucumbers, tomatoes, and shredded carrots on the side for crunch.

Total time
10 min
Servings
2
Calories
340
Protein
12g
10-Min Egg Fried Rice with Crispy Veg
quicksatisfyingasianvegetarianeggscrispyfluffyweeknight

Ingredients

  • 2 cups cooked rice, day-old or chilled
  • 3 whole egg
  • 1 cup frozen mixed vegetables
  • 2 tbsp soy sauce

Instructions

  1. 1

    Heat oil in a large skillet over high heat until it shimmers, about 90 seconds.

  2. 2

    Crack eggs into the skillet, scramble with a spatula for 60 seconds until mostly set, then push to the side.

  3. 3

    Add frozen vegetables to the empty space, stir constantly for 2 minutes until they start to caramelize.

  4. 4

    Pour in rice, breaking up clumps with the spatula, and toss everything together for 3 minutes.

  5. 5

    Drizzle soy sauce over the rice, toss for 1 minute until the rice is glossy and heated through.

  6. 6

    Plate the fried rice and serve with cucumber slices, cherry tomatoes, shredded carrots, and lettuce on the side.

Tools you’ll need

  • large skillet or wok (12-inch minimum)
  • spatula
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.