Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Eggs Florentine with Hollandaise

Poached eggs and wilted spinach on toasted English muffins, topped with silky hollandaise. A showstopping breakfast that tastes fancy but comes together in 30 minutes.

Total time
30 min
Servings
2
Calories
512
Protein
18g
Eggs Florentine with Hollandaise
elegantindulgentfrenchvegetarianeggscreamytendercrispy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Melt 6 tbsp butter in a small saucepan over low heat, ~2 minutes. Set aside.

  2. Step 2

    Whisk 3 egg yolks with 1 tbsp lemon juice in a heatproof bowl.

  3. Step 3

    Set bowl over (not touching) simmering water. Whisk constantly until pale and thick, ~4 minutes.

  4. Step 4

    Remove from heat. Drizzle in melted butter while whisking constantly until silky and pale.

  5. Step 5

    Season with salt and pepper. Cover loosely and set aside.

  6. Step 6

    Toast English muffins until edges crisp, ~3 minutes. Transfer to plates.

  7. Step 7

    Heat 1 tbsp butter in a large skillet over medium. Add spinach and cook until wilted, ~1 minute.

  8. Step 8

    Season spinach with salt and pepper. Divide evenly between muffin halves.

  9. Step 9

    Bring a shallow pot of water to a bare simmer. Add 1 tbsp white vinegar.

  10. Step 10

    Crack 1 egg into a small cup. Gently slide into simmering water. Repeat with remaining eggs.

  11. Step 11

    Poach until whites set but yolks still jiggle when shaken, ~3 minutes.

  12. Step 12

    Remove eggs with a slotted spoon. Set 1 egg on each spinach-topped muffin half.

  13. Step 13

    Spoon hollandaise over eggs. Serve immediately.

Tools you’ll need

  • small saucepan
  • heatproof bowl
  • whisk
  • large skillet
  • shallow poaching pot
  • slotted spoon
  • toaster
  • plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.