CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Everything Bagel Avocado Toast

Creamy avocado spread on crispy toast, topped with a savory everything bagel seasoning blend and a squeeze of fresh lemon. Ready in 10 minutes with minimal cleanup.

Total time
10 min
Servings
2
Calories
280
Protein
8g
Everything Bagel Avocado Toast
freshsimplequickamericanvegetarianveganvegancrispy

Ingredients

  • 4 slices bread, sliced
  • 2 whole avocado, ripe
  • 1 tablespoon everything bagel seasoning
  • ½ whole lemon
  • 1 pinch salt and pepper
  • 1 teaspoon olive oil

Instructions

  1. 1

    Place the bread slices on a toaster oven rack or in a toaster and toast them until the surface turns golden brown and feels crisp when you tap it, about 2–3 minutes.

  2. 2

    While the bread toasts, cut each avocado in half lengthwise from the pointed end to the rounded end, rotating it around the pit until the knife cuts all the way through.

  3. 3

    Twist the two halves apart, remove the pit by pressing the blade of a knife into it and twisting, then scoop the avocado flesh out with a spoon into a small bowl.

  4. 4

    Mash the avocado with a fork until it is creamy but still has small chunks visible, about 10–15 mashes.

  5. 5

    Squeeze the lemon half over the avocado, sprinkle with salt and pepper, and stir with the fork until evenly blended.

  6. 6

    Remove the toast from the toaster and place all four slices on a plate or cutting board in front of you.

  7. 7

    Divide the avocado mixture evenly among the four toast slices, spreading it with the back of the fork in a thin, even layer.

  8. 8

    Sprinkle 1 teaspoon of everything bagel seasoning over each slice, making sure to coat the avocado lightly and evenly.

  9. 9

    Drizzle each slice with a quarter-teaspoon of olive oil, let the oil pool slightly on the surface, then serve immediately while the toast is still warm.

Tools you’ll need

  • toaster or toaster oven
  • cutting board
  • sharp knife
  • small bowl
  • fork
  • spoon
  • small plate or cutting board for plating

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.