CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Feta Fried Eggs with Crispy Tortilla

Eggs sizzle in olive oil until the whites set and yolks stay runny, then crumbled feta melts into the pan. Serve with warm tortilla for scooping and whatever fresh toppings you have on hand.

Total time
12 min
Servings
2
Calories
340
Protein
14g
Feta Fried Eggs with Crispy Tortilla
simplequickamericanvegetarianeggscrispyrunnycreamy

Ingredients

  • 2 tbsp olive oil
  • 4 whole eggs
  • ½ cup feta cheese
  • 2 whole tortilla

Instructions

  1. 1

    Heat olive oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Crack eggs into the skillet without stirring; cook until whites are set but yolks jiggle, 3–4 minutes.

  3. 3

    Scatter feta cheese over the eggs, then remove from heat and let it soften for 30 seconds.

  4. 4

    Warm tortillas in a dry skillet or over a flame until pliable, about 1 minute per side.

  5. 5

    Slide eggs onto a plate alongside tortillas; serve with tomatoes, cucumbers, olives, and orange juice if desired.

Tools you’ll need

  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.