Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Minute French Crêpes

Delicate, paper-thin crêpes that crisp at the edges and finish in under 5 minutes. Serve warm with jam, Nutella, fresh fruit, or a squeeze of lemon and sugar.

Total time
20 min
Servings
2
Calories
285
Protein
7g
5-Minute French Crêpes
lightelegantcasualfrenchvegetarianeggscreamycrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine flour, eggs, milk, melted butter, salt, and pinch of sugar in a bowl.

  2. Step 2

    Whisk until smooth and thin, like heavy cream. Let rest 5 minutes.

  3. Step 3

    Heat an 8-inch nonstick skillet over medium-high until water flicks sizzle, ~90 seconds.

  4. Step 4

    Pour 1/4 cup batter into the center, immediately tilt and rotate the pan to spread thin.

  5. Step 5

    Cook 60-90 seconds until the bottom is light gold, then flip and cook 30 seconds on the other side.

  6. Step 6

    Slide onto a plate. Repeat with remaining batter. Spread with jam, add fruit, roll or fold, and serve warm.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • 8-inch nonstick skillet
  • rubber spatula
  • dinner plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.