Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Flan con Dulce de Leche

A silky Argentine custard with a caramel-dulce de leche layer and crispy sugar shell. Rich, elegant, and absolutely worth the time.

Total time
75 min
Servings
6
Calories
412
Protein
7g
Flan con Dulce de Leche
elegantindulgentargentinianvegetariansilkycreamycrispydinner

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine 1 cup sugar and 3 tbsp water in a saucepan over medium-high heat.

  2. Step 2

    Do not stir. Swirl the pan occasionally until the sugar dissolves and turns deep amber, ~8 minutes.

  3. Step 3

    Remove from heat. Immediately pour the caramel into a 9-inch round baking dish, coating the bottom evenly.

  4. Step 4

    Heat milk and cream in a saucepan over medium until steaming, ~4 minutes. Do not boil.

  5. Step 5

    In a bowl, whisk 5 eggs, 1 egg yolk, and 0.5 cup sugar until pale, ~2 minutes.

  6. Step 6

    Slowly pour the hot milk into the egg mixture while whisking constantly to temper.

  7. Step 7

    Stir in 1 tsp vanilla and 0.25 tsp salt. Strain through a fine-mesh sieve into a bowl.

  8. Step 8

    Drop spoonfuls of dulce de leche over the caramel base, then slowly pour custard over.

  9. Step 9

    Place the baking dish in a larger roasting pan. Fill the roasting pan with hot water halfway up the flan.

  10. Step 10

    Bake at 325°F for 40–45 minutes until the custard is set but jiggles slightly in the center.

  11. Step 11

    Cool completely, then refrigerate for at least 4 hours or overnight.

  12. Step 12

    Run a knife around the edges, then invert onto a shallow plate. The caramel should flow over the top.

  13. Step 13

    Serve chilled or at room temperature.

Tools you’ll need

  • 9-inch round baking dish
  • roasting pan
  • saucepan
  • whisk
  • mixing bowl
  • fine-mesh sieve
  • knife
  • shallow serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.