Back to recipes
4-Ingredient Butter Cookies
Ultra-simple drop cookies made from just butter, sugar, flour, and egg. Mix, drop, bake—done in 20 minutes.
- Total time
- 20 min
- Servings
- 12
- Calories
- 156
- Protein
- 2g
simpleamericanvegetariancrispytenderweeknightcookiedessert
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 350°F and line a baking sheet with parchment.
Step 2
Beat butter and sugar together until light and fluffy, about 2 minutes.
Step 3
Add egg and mix until combined.
Step 4
Stir in flour until no dry streaks remain.
Step 5
Drop spoonfuls onto the sheet, spacing them 1 inch apart.
Step 6
Bake 10–12 minutes until edges turn golden; centers stay soft.
Tools you’ll need
- oven
- baking sheet
- parchment paper
- mixing bowl
- electric mixer or whisk
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
