Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Garlic Aioli Seafood Platter

Silky homemade garlic aioli paired with quick-seared shrimp and crispy baguette. A Provençal classic that feels fancy but takes 20 minutes.

Total time
20 min
Servings
2
Calories
680
Protein
28g
20-Min Garlic Aioli Seafood Platter
elegantsimplefrenchmediterraneanshrimpcrispysilkytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk egg yolk and minced garlic in a bowl until pale, about 1 minute.

  2. Step 2

    Add oil drop by drop while whisking constantly until mixture thickens and emulsifies, ~3 minutes.

  3. Step 3

    Once aioli is creamy, whisk in lemon juice and a pinch of salt. Set aside.

  4. Step 4

    Heat 2 tbsp oil in a skillet over medium-high until it shimmers, about 90 seconds.

  5. Step 5

    Sear shrimp in a single layer, 90 seconds per side without stirring until opaque throughout.

  6. Step 6

    Toast baguette slices in the same skillet, 1 minute per side until golden, then serve alongside shrimp and aioli.

Tools you’ll need

  • mixing bowl
  • whisk
  • 12-inch skillet
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.