CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Ginisang Ampalaya

A classic Filipino bitter melon stir-fry with eggs, garlic, and onions. Quick, savory, and deeply satisfying—ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
178
Protein
8g
Ginisang Ampalaya
comfortsimplefilipinovegetarianeggstendercrispyweeknight

Ingredients

  • 1 lb bitter melon (ampalaya)
  • 4 cloves, minced garlic
  • 1 medium, sliced onion
  • 3 large eggs
  • 3 tbsp olive oil
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Halve the bitter melon lengthwise and scoop out the seeds with a spoon.

  2. 2

    Slice the melon crosswise into 1/4-inch crescents.

  3. 3

    Beat the eggs in a bowl with a pinch of salt.

  4. 4

    Heat 2 tbsp oil in a 12-inch skillet over medium-high heat until it shimmers, ~90 seconds.

  5. 5

    Add bitter melon and sauté until soft and edges brown, ~5 minutes.

  6. 6

    Push melon to the side. Add remaining 1 tbsp oil and sauté garlic and onion until fragrant, ~2 minutes.

  7. 7

    Pour beaten eggs over the mixture and stir constantly until fully cooked, ~3 minutes.

  8. 8

    Season with salt and pepper to taste.

  9. 9

    Serve hot over rice.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • cutting board
  • knife
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.