Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Ginisang Ampalaya

A classic Filipino bitter melon stir-fry with eggs, garlic, and onions. Quick, savory, and deeply satisfying—ready in under 20 minutes.

Total time
20 min
Servings
4
Calories
178
Protein
8g
Ginisang Ampalaya
comfortsimplefilipinovegetarianeggstendercrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the bitter melon lengthwise and scoop out the seeds with a spoon.

  2. Step 2

    Slice the melon crosswise into 1/4-inch crescents.

  3. Step 3

    Beat the eggs in a bowl with a pinch of salt.

  4. Step 4

    Heat 2 tbsp oil in a 12-inch skillet over medium-high heat until it shimmers, ~90 seconds.

  5. Step 5

    Add bitter melon and sauté until soft and edges brown, ~5 minutes.

  6. Step 6

    Push melon to the side. Add remaining 1 tbsp oil and sauté garlic and onion until fragrant, ~2 minutes.

  7. Step 7

    Pour beaten eggs over the mixture and stir constantly until fully cooked, ~3 minutes.

  8. Step 8

    Season with salt and pepper to taste.

  9. Step 9

    Serve hot over rice.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • cutting board
  • knife
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.