Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Gochujang Beef Skewers with Charred Vegetables

Marinated beef cubes with Korean gochujang glaze, grilled until caramelized, served with quick-charred broccoli, green beans, peppers, and carrots. Ready in under 30 minutes.

Total time
28 min
Servings
2
Calories
445
Protein
42g
Gochujang Beef Skewers with Charred Vegetables
satisfyingboldkoreanbeeftendercharredcrispyweeknight

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix gochujang, soy sauce, sesame oil, garlic, and brown sugar in a bowl until smooth.

  2. Step 2

    Add beef cubes and toss to coat evenly. Let sit while you prep the vegetables.

  3. Step 3

    Heat a large skillet or grill pan over medium-high heat until it shimmers.

  4. Step 4

    Working in batches, sear beef 2–3 minutes per side until caramelized but still pink in the center. Transfer to a plate.

  5. Step 5

    Add broccoli, green beans, peppers, and carrots to the same pan. Stir-fry 6–8 minutes until edges char and vegetables are tender-crisp.

  6. Step 6

    Return beef to the pan, toss gently to combine, and serve immediately while hot.

Tools you’ll need

  • 12-inch skillet or grill pan
  • medium mixing bowl
  • knife and cutting board
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.