Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Golden Cornmeal Hush Puppies

Crispy-outside, tender-inside fried cornmeal balls that are pure Southern comfort in under 30 minutes. Serve hot with honey or hot sauce for dipping.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Golden Cornmeal Hush Puppies
comfortcasualsouthernvegetarianvegetariancrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk cornmeal, flour, 1 tsp salt, and 0.5 tsp black pepper in a large bowl.

  2. Step 2

    Whisk egg and milk together in a separate bowl, then pour into the dry mixture and stir until just combined.

  3. Step 3

    Fold in the chopped scallions. Batter should be thick and spoonable, not runny.

  4. Step 4

    Heat oil in a heavy pot or deep skillet to 350°F on a deep-fry thermometer, about 5–8 minutes.

  5. Step 5

    Using a small cookie scoop or spoon, drop 1-inch balls into the hot oil in batches (don't overcrowd). Fry 2–3 minutes until deep golden brown.

  6. Step 6

    Remove with a slotted spoon and drain on paper towels. Serve hot with honey or hot sauce.

Tools you’ll need

  • large mixing bowl
  • separate small bowl
  • whisk
  • heavy pot or deep skillet (3+ quart capacity)
  • deep-fry thermometer
  • small cookie scoop or spoon
  • slotted spoon
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.