Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Golden Waffles with Whipped Cream & Strawberries

Crispy-outside, fluffy-inside waffles topped with fresh whipped cream and juicy strawberries. Ready in 20 minutes with a standard waffle iron.

Total time
20 min
Servings
2
Calories
520
Protein
12g
Golden Waffles with Whipped Cream & Strawberries
indulgentcasualamericanvegetarianeggscrispyfluffycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat waffle iron. Whisk flour, baking powder, and a pinch of salt in a bowl.

  2. Step 2

    Whisk eggs and milk together, then fold into flour mixture until just combined—some lumps are fine.

  3. Step 3

    Pour batter into waffle iron until 3/4 full. Cook until golden and crispy, ~4 minutes per waffle.

  4. Step 4

    While waffles cook, whip heavy cream with 1 tbsp sugar until soft peaks form.

  5. Step 5

    Hull strawberries, slice in half, and toss with 1 tbsp sugar to release juice.

  6. Step 6

    Stack warm waffles on plates, top with whipped cream and strawberries, and serve immediately.

Tools you’ll need

  • waffle iron
  • medium mixing bowl
  • whisk
  • measuring cups and spoons
  • chef's knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.