Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Lemon Pepper Salmon with Garden Salad

Pan-seared salmon fillets crusted with lemon pepper seasoning, finished with melting butter. Serve with a crisp garden salad and a light soy dipping sauce on the side.

Total time
15 min
Servings
2
Calories
340
Protein
36g
Grilled Lemon Pepper Salmon with Garden Salad
freshsimpleamericansalmoncrispytenderweeknightmain-dish

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat salmon dry with paper towels, then season both sides generously with lemon pepper.

  2. Step 2

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  3. Step 3

    Sear salmon skin-side up for 3 minutes until the skin crisps and flesh turns opaque halfway up.

  4. Step 4

    Flip carefully and sear 2 minutes more until the center flakes gently under a fork.

  5. Step 5

    Add butter to the pan and tilt it over the fillets until melted and foamy, about 30 seconds.

  6. Step 6

    Slide onto plates and serve with garden salad and soy dipping sauce on the side.

Tools you’ll need

  • 12-inch skillet
  • paper towels
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.