Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Halawet El Jibn — Sweet Cheese Rolls & Dates

Warm, stretchy cheese rolls soaked in rose-infused syrup and topped with crushed pistachios. Served with dates and black tea for an elegant Lebanese dessert that feels like a hug.

Total time
25 min
Servings
4
Calories
520
Protein
18g
Halawet El Jibn — Sweet Cheese Rolls & Dates
elegantindulgentlebanesevegetarianchewycrispymeltyBread

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine sugar and water in a small pot. Bring to a boil, then simmer 5 minutes until syrupy.

  2. Step 2

    Remove from heat and stir in rose water. Set aside to cool slightly.

  3. Step 3

    Pat the white cheese dry. Layer a piece of string cheese flat, place mozzarella in the center, then roll tightly into a cylinder.

  4. Step 4

    Heat a skillet over medium-high until very hot. Pan-fry each roll seam-side down until golden and cheese starts to ooze, ~2 minutes per side.

  5. Step 5

    Transfer rolls to a shallow bowl. Pour warm rose syrup over them immediately.

  6. Step 6

    Top with crushed pistachios. Serve warm alongside dates and hot black tea.

Tools you’ll need

  • small pot
  • 12-inch nonstick skillet or cast iron
  • shallow serving bowl
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.