Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Har Gow (Shrimp & Bamboo Shoot Dumplings)

Delicate, translucent shrimp dumplings with bamboo shoot and chive filling, steamed until tender. A dim sum classic that's easier to fold than you'd think.

Total time
50 min
Servings
4
Calories
180
Protein
12g
Har Gow (Shrimp & Bamboo Shoot Dumplings)
elegantcasualchineseshrimptenderchewysilkyweeknight

Ingredients

10 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix wheat starch, potato starch, and salt in a bowl.

  2. Step 2

    Pour boiling water into the dry mixture while stirring with a fork until shaggy.

  3. Step 3

    Once cool enough to handle, knead in vegetable oil until smooth, ~2 minutes.

  4. Step 4

    Cover dough with plastic wrap and let rest 10 minutes.

  5. Step 5

    Combine shrimp, bamboo shoot, green onion, soy sauce, and sesame oil in a bowl.

  6. Step 6

    Stir until evenly mixed. Set aside.

  7. Step 7

    Divide dough into 12 equal pieces. Roll each into a thin 3-inch circle on oiled plastic.

  8. Step 8

    Place 1 tbsp filling on each wrapper. Fold and pleat edges to seal, creating a half-moon.

  9. Step 9

    Line a steamer basket with parchment paper. Arrange dumplings without touching.

  10. Step 10

    Steam over boiling water for 6 minutes until wrapper turns translucent.

  11. Step 11

    Serve hot with soy sauce or chili oil for dipping.

Tools you’ll need

  • mixing bowl
  • fork
  • plastic wrap
  • rolling pin (or smooth glass)
  • plastic sheet or parchment paper
  • steamer basket
  • parchment paper
  • pot with lid (for steamer)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.