Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Hawaiian Shrimp Fried Rice with Spam & Pineapple

Crispy shrimp and spam fried rice with caramelized pineapple chunks and a soy-butter glaze. Ready in 20 minutes, served with strawberries and cold milk for a sweet tropical finish.

Total time
20 min
Servings
2
Calories
620
Protein
38g
Hawaiian Shrimp Fried Rice with Spam & Pineapple
comfortcasualhawaiianshrimpcrispytenderfluffyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp butter in a large skillet over medium-high until foaming, then brown the diced spam until edges crisp, ~4 minutes.

  2. Step 2

    Push spam to the side, crack eggs into the empty space and scramble until cooked through, then mix with spam.

  3. Step 3

    Add shrimp and the remaining 1 tbsp butter; toss until heated through, about 2 minutes.

  4. Step 4

    Add rice, breaking up clumps as you stir, then drizzle soy sauce over and toss until every grain looks glossy, ~2 minutes.

  5. Step 5

    Fold in pineapple chunks and green onion; cook for 1 minute until fragrant, then slide onto a serving plate.

  6. Step 6

    Serve warm with fresh strawberries and cold milk on the side.

Tools you’ll need

  • large skillet (12-inch)
  • spatula or wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.