Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kräuterquark mit Kartoffeln

Tender boiled potatoes served with a creamy herb-studded quark sauce, a classic German comfort dish. Naturally vegetarian, ready in under 25 minutes.

Total time
22 min
Servings
2
Calories
215
Protein
14g
Kräuterquark mit Kartoffeln
comfortwholesomegermanvegetarianvegetariancreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place potatoes in a large pot and cover them completely with cold water from the tap, about 2 inches above the potatoes.

  2. Step 2

    Add 1 teaspoon salt to the water, then bring to a boil over high heat—you'll see large, rolling bubbles breaking across the entire surface.

  3. Step 3

    Once boiling, reduce heat to medium and simmer gently until a fork slides through the thickest potato with no resistance, about 15–18 minutes.

  4. Step 4

    Drain the potatoes in a colander and let them sit in the pot off the heat for 2 minutes to dry slightly.

  5. Step 5

    While potatoes cook, place quark in a small bowl, then stir in the dill, chives, and 0.25 teaspoon black pepper until the herbs are evenly distributed.

  6. Step 6

    Divide the warm potatoes between two plates, mounding them in the center of each plate.

  7. Step 7

    Spoon half of the herb quark sauce onto the side of each plate's potatoes—the sauce should sit in a generous dollop next to, not covering, the potatoes.

Tools you’ll need

  • large pot (4–5 quart)
  • colander
  • small mixing bowl
  • wooden spoon
  • fork
  • two dinner plates

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.