Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Homemade Biscuits

Buttery, flaky biscuits that taste like they came straight from a bakery—ready in under 30 minutes. Perfect warm with jam, honey, or gravy.

Total time
25 min
Servings
8
Calories
180
Protein
3g
Homemade Biscuits
cozycomfortsimpleamericanvegetarianflakytenderfluffy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 450°F. Line a baking sheet with parchment paper.

  2. Step 2

    Whisk flour, baking powder, and salt in a large bowl.

  3. Step 3

    Cube the cold butter into small pieces. Add to the flour and work with your fingertips until mixture resembles coarse breadcrumbs.

  4. Step 4

    Pour buttermilk into the bowl. Stir with a fork until a shaggy dough forms.

  5. Step 5

    Turn dough onto a floured surface and fold it over itself 5–6 times to create layers.

  6. Step 6

    Pat dough into a 1-inch-thick rectangle. Cut into 2-inch rounds with a biscuit cutter or drinking glass.

  7. Step 7

    Place biscuits on the baking sheet 1 inch apart. Brush tops with melted butter.

  8. Step 8

    Bake 12–15 minutes until tops are golden brown.

  9. Step 9

    Remove from oven and cool for 2 minutes. Serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • parchment paper
  • large mixing bowl
  • whisk
  • fork
  • cutting board
  • biscuit cutter or drinking glass
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.