CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Homemade Cappuccino

Equal parts espresso, steamed milk, and milk foam — the classic Italian café drink. Ready in under 5 minutes with an espresso machine or strong brewed coffee.

Total time
5 min
Servings
1
Calories
135
Protein
8g
Homemade Cappuccino
cozysimpleitalianvegetariancreamysilkybreakfastbrunch

Ingredients

  • 1 double shot (2 oz) espresso
  • 4 oz whole milk
  • ½ tsp (optional) sugar

Instructions

  1. 1

    Pull a double shot of espresso (about 2 oz) into a cappuccino cup.

  2. 2

    Steam 4 oz of cold whole milk until it reaches 150–155°F and a smooth microfoam forms.

  3. 3

    Pour the steamed milk into the espresso, holding back the foam with a spoon to pour only liquid first.

  4. 4

    Top with a thick layer of milk foam (about 1/4 inch). Add sugar if desired and serve immediately.

Tools you’ll need

  • espresso machine with steam wand
  • cappuccino cup (5–6 oz ceramic)
  • milk pitcher or frothing jug
  • spoon
  • thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.