Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Homemade Cappuccino

Equal parts espresso, steamed milk, and milk foam — the classic Italian café drink. Ready in under 5 minutes with an espresso machine or strong brewed coffee.

Total time
5 min
Servings
1
Calories
135
Protein
8g
Homemade Cappuccino
cozysimpleitalianvegetariancreamysilkybreakfastbrunch

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pull a double shot of espresso (about 2 oz) into a cappuccino cup.

  2. Step 2

    Steam 4 oz of cold whole milk until it reaches 150–155°F and a smooth microfoam forms.

  3. Step 3

    Pour the steamed milk into the espresso, holding back the foam with a spoon to pour only liquid first.

  4. Step 4

    Top with a thick layer of milk foam (about 1/4 inch). Add sugar if desired and serve immediately.

Tools you’ll need

  • espresso machine with steam wand
  • cappuccino cup (5–6 oz ceramic)
  • milk pitcher or frothing jug
  • spoon
  • thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.