Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Homemade Ricotta Ravioli

Fresh pasta pillows filled with creamy ricotta and herbs, boiled until they float, then finished with butter and sage. Restaurant-quality in 45 minutes.

Total time
45 min
Servings
4
Calories
520
Protein
18g
Homemade Ricotta Ravioli
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mound flour on a clean surface. Make a well in the center with your fingers.

  2. Step 2

    Crack eggs into the well and whisk lightly with a fork, breaking the yolks.

  3. Step 3

    Gradually incorporate flour into the egg mixture, drawing from the inner walls. Knead until shaggy, ~2 minutes.

  4. Step 4

    Continue kneading until smooth and elastic, about 8–10 minutes. Cover and rest 15 minutes.

  5. Step 5

    Mix ricotta, Parmesan, parsley, sage, and a pinch of salt in a bowl until combined.

  6. Step 6

    Divide dough into 4 pieces. Working with one piece at a time, roll thin on a floured surface, ~1/16-inch.

  7. Step 7

    Cut into 2-inch circles using a round cutter or glass. Place 1 tsp filling in center of each.

  8. Step 8

    Fold each circle in half, pressing edges firmly to seal. Crimp with a fork for a decorative seal.

  9. Step 9

    Bring a large pot of salted water to a boil. Working in batches, add ravioli without crowding.

  10. Step 10

    Stir gently and cook until ravioli rise to the surface, then 1–2 minutes more until tender.

  11. Step 11

    Remove with a slotted spoon and transfer to a serving dish. Repeat with remaining ravioli.

  12. Step 12

    Melt butter in a small pan over medium-low heat. Pour over ravioli, tossing gently to coat.

  13. Step 13

    Season with salt and black pepper. Serve hot with extra Parmesan on the side.

Tools you’ll need

  • large work surface
  • rolling pin
  • 2-inch round cutter
  • fork
  • large pot
  • slotted spoon
  • small saucepan
  • mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.