Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Hot Honey Chicken Nachos

Crispy tortilla chips topped with shredded rotisserie chicken, melted cheese, and a spicy-sweet hot honey drizzle. Ready in under 10 minutes—perfect for snacking or sharing.

Total time
8 min
Servings
2
Calories
520
Protein
28g
Hot Honey Chicken Nachos
indulgentcasualamericanchickencrispymeltytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Melt butter in a small skillet over medium heat, about 1 minute.

  2. Step 2

    Whisk in honey and hot sauce until smooth and fragrant, ~30 seconds.

  3. Step 3

    Remove from heat and set aside while you assemble nachos.

  4. Step 4

    Spread chips on a plate or shallow bowl in a single, overlapping layer.

  5. Step 5

    Top chips evenly with shredded chicken, then sprinkle cheddar over the top.

  6. Step 6

    Microwave on high until cheese melts, 90–120 seconds, checking halfway.

  7. Step 7

    Drizzle hot honey over nachos. Scatter cilantro on top and serve immediately.

Tools you’ll need

  • small skillet
  • whisk
  • plate or shallow bowl
  • microwave

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.