CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Hot Honey Chicken Nachos

Crispy tortilla chips topped with shredded rotisserie chicken, melted cheese, and a spicy-sweet hot honey drizzle. Ready in under 10 minutes—perfect for snacking or sharing.

Total time
8 min
Servings
2
Calories
520
Protein
28g
Hot Honey Chicken Nachos
indulgentcasualamericanchickencrispymeltytenderweeknight

Ingredients

  • 4 cups tortilla chips
  • 1.5 cups rotisserie chicken, shredded
  • 1 cup sharp cheddar, shredded
  • 3 tbsp honey
  • 1.5 tbsp hot sauce (cayenne or frank's)
  • 1 tbsp butter
  • 2 tbsp fresh cilantro or scallions, chopped

Instructions

  1. 1

    Melt butter in a small skillet over medium heat, about 1 minute.

  2. 2

    Whisk in honey and hot sauce until smooth and fragrant, ~30 seconds.

  3. 3

    Remove from heat and set aside while you assemble nachos.

  4. 4

    Spread chips on a plate or shallow bowl in a single, overlapping layer.

  5. 5

    Top chips evenly with shredded chicken, then sprinkle cheddar over the top.

  6. 6

    Microwave on high until cheese melts, 90–120 seconds, checking halfway.

  7. 7

    Drizzle hot honey over nachos. Scatter cilantro on top and serve immediately.

Tools you’ll need

  • small skillet
  • whisk
  • plate or shallow bowl
  • microwave

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.