Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Ipoh Hor Fun with Shrimp

Silky flat rice noodles tossed with succulent shrimp in a light soy-based sauce with bean sprouts and scallions. Ready in 20 minutes—a Malaysian street-food classic.

Total time
20 min
Servings
2
Calories
385
Protein
22g
Ipoh Hor Fun with Shrimp
lightfreshmalaysianshrimpsilkytendercrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry with a paper towel by pressing each shrimp gently against the towel until no visible moisture remains, so they will brown properly in the pan.

  2. Step 2

    Gently separate the hor fun noodles with your fingers into loose clumps, breaking up any that are stuck together into individual noodle bunches.

  3. Step 3

    Pour the soy sauce and sesame oil into a small bowl and stir with a spoon until combined, about 10 seconds.

  4. Step 4

    Heat 2 tablespoons of oil in a large 12-inch skillet over medium-high heat until the oil shimmers and slides quickly when you tilt the pan, about 90 seconds.

  5. Step 5

    Add the shrimp in a single layer and let sit undisturbed for 90 seconds until the bottoms turn opaque pink, then flip each shrimp over.

  6. Step 6

    Cook the shrimp for another 60 seconds until the second side turns opaque pink all the way through, then use a slotted spoon to transfer them to a clean plate.

  7. Step 7

    Add the hor fun noodles to the same hot skillet in a single layer and let them sit undisturbed for 90 seconds until the bottom side turns golden brown.

  8. Step 8

    Stir the noodles with a wooden spoon, breaking up any clumps, and cook for another 60 seconds until they are heated through and beginning to brown in patches.

  9. Step 9

    Pour the soy-sesame mixture over the noodles and stir constantly for 30 seconds until the sauce coats every noodle and the pan looks glistening.

  10. Step 10

    Return the shrimp to the skillet, add the bean sprouts and scallions, and stir everything together for 30 seconds until the sprouts just begin to soften.

  11. Step 11

    Divide the noodles and shrimp between two bowls or plates using tongs, making sure to distribute the shrimp, sprouts, and scallions equally.

Tools you’ll need

  • 12-inch skillet
  • small bowl
  • wooden spoon
  • slotted spoon
  • tongs
  • paper towels
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.