Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Kashmiri Dum Aloo with Roti

Tender baby potatoes in a silky tomato-yogurt curry spiked with Kashmiri chili and ginger. Served with warm roti for scooping up every last drop of that rich red gravy.

Total time
20 min
Servings
2
Calories
320
Protein
8g
20-Min Kashmiri Dum Aloo with Roti
comfortcozyindianvegetarianvegetariancreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until just tender, 8–10 minutes. Drain well.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium. Add ginger and cook 30 seconds until fragrant.

  3. Step 3

    Stir in Kashmiri chili powder, then add yogurt and tomatoes. Mix until smooth.

  4. Step 4

    Add cooked potatoes and a pinch of salt. Simmer 5 minutes, stirring gently, until sauce coats the potatoes.

  5. Step 5

    Warm roti in a dry pan or directly over a low flame, 20 seconds per side.

  6. Step 6

    Serve curry hot alongside warm roti.

Tools you’ll need

  • large saucepan (for boiling potatoes)
  • large skillet (for curry)
  • wooden spoon
  • dry skillet or tongs (for warming roti)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.