Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kaya Toast with Soft Eggs & Lime

Crispy buttered toast spread with sweet coconut kaya, paired with jammy soft-boiled eggs and cooling cucumber slices. A Malaysian breakfast classic ready in under 10 minutes.

Total time
10 min
Servings
2
Calories
385
Protein
12g
Kaya Toast with Soft Eggs & Lime
casualquickmalaysianvegetarianeggscrispycreamysoft

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a small pot of salted water to a boil. Gently lower eggs and cook for 6–7 minutes until whites are set but yolks still jiggle.

  2. Step 2

    While eggs cook, spread kaya on one side of each bread slice. Heat butter in a large skillet over medium heat until it foams.

  3. Step 3

    Toast kaya-spread bread in the butter for 2–3 minutes per side until golden and crispy, pressing gently.

  4. Step 4

    Slice cucumber into thin rounds. Cut calamansi or lime into wedges for squeezing.

  5. Step 5

    Remove eggs from water and crack into a small bowl. Plate toast, eggs, cucumbers, and lime wedges together.

  6. Step 6

    Serve immediately while toast is still warm and eggs are soft.

Tools you’ll need

  • small pot
  • large skillet
  • cutting board
  • knife
  • slotted spoon
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.