Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kung Pao Chicken

A classic Sichuan dish with tender chicken, roasted peanuts, and dried chilies in a savory-sweet sauce. Quick to prepare and bursting with bold, spicy flavor.

Total time
25 min
Servings
4
Calories
420
Protein
45g
Kung Pao Chicken
chinesesichuanchickenspicystir-fryweeknight dinner

Ingredients

13 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut chicken breasts into 0.75-inch cubes. Set aside.

  2. Step 2

    Whisk together soy sauce, rice vinegar, sugar, sesame oil, cornstarch, and water in a small bowl. Set sauce aside.

  3. Step 3

    Remove seeds from dried chilies (optional, for less heat) and cut into 1-inch pieces.

  4. Step 4

    Heat 1.5 tbsp vegetable oil in a 14-inch wok or large skillet over high heat until shimmering.

  5. Step 5

    Add chicken cubes and stir-fry until golden on all sides and cooked through, 6-8 minutes. Transfer to a plate.

  6. Step 6

    Add remaining 1.5 tbsp oil to the wok. Add dried chilies and toast for 30 seconds until fragrant.

  7. Step 7

    Add garlic and ginger, stir-fry for 30 seconds until fragrant.

  8. Step 8

    Return chicken to the wok. Add peanuts and green onions.

  9. Step 9

    Pour in sauce and toss everything together over high heat for 1-2 minutes until sauce thickens and coats all ingredients.

  10. Step 10

    Transfer to serving bowl and serve immediately over steamed rice.

Tools you’ll need

  • 14-inch wok or large skillet
  • cutting board
  • chef's knife
  • small mixing bowl
  • wooden spoon or wok spatula
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.