Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lau Bo Beef & Greens

Vietnamese beef and spinach sautéed in a garlicky, umami-rich sauce with fish sauce and lime. A weeknight one-pan dinner that tastes like a restaurant dish in under 10 minutes.

Total time
12 min
Servings
2
Calories
285
Protein
32g
Lau Bo Beef & Greens
quickfreshvietnamesebeeftendercrispyweeknightmain-dish

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice beef against the grain into thin strips, about 1/4-inch thick. Pat dry with a paper towel.

  2. Step 2

    Heat 1 tbsp olive oil in a large skillet over medium-high heat until it shimmers, about 90 seconds.

  3. Step 3

    Working in one batch, sear beef 60 seconds per side without stirring—edges should look caramelized. Transfer to a plate.

  4. Step 4

    Add remaining oil, then cook shallot and garlic until fragrant, 30 seconds. Stir constantly so garlic doesn't burn.

  5. Step 5

    Add spinach, fish sauce, and soy sauce. Toss until greens wilt, about 60 seconds. Greens will shrink noticeably.

  6. Step 6

    Return beef to the skillet. Drizzle with sesame oil and squeeze lime juice over top. Toss gently and serve.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon
  • paper towels
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.