Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lebanese Balila Breakfast Bowl

Creamy slow-cooked chickpeas infused with garlic and cumin, finished with a runny egg and a drizzle of lemon oil. A warming, protein-packed Lebanese classic.

Total time
35 min
Servings
2
Calories
285
Protein
12g
Lebanese Balila Breakfast Bowl
wholesomecomfortmiddle-easternvegetarianchickpeascreamysoftBreakfast

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a medium pot over medium heat until shimmering, ~90 seconds.

  2. Step 2

    Add minced garlic and cumin. Stir until fragrant, about 30 seconds.

  3. Step 3

    Add drained chickpeas and 1/2 cup water. Stir to combine.

  4. Step 4

    Simmer uncovered over medium-low heat for 20 minutes, stirring occasionally, until chickpeas are creamy and broth thickens slightly.

  5. Step 5

    Season with salt and pepper to taste.

  6. Step 6

    Make two small wells in the chickpea mixture. Crack eggs into each well.

  7. Step 7

    Cover pot and cook over medium-low heat until whites set but yolks still jiggle, 4–5 minutes.

  8. Step 8

    Drizzle with remaining 1 tbsp olive oil. Squeeze fresh lemon juice over the top.

  9. Step 9

    Garnish with fresh parsley or sumac if desired. Serve hot with warm pita or flatbread.

Tools you’ll need

  • medium pot with lid
  • wooden spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.