Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lebanese Cheese Manoushe

Crispy-bottomed flatbread topped with melted cheese and fresh herbs, ready in under 20 minutes. A beloved Lebanese street food you can make at home with pantry staples and simple technique.

Total time
18 min
Servings
2
Calories
485
Protein
16g
Lebanese Cheese Manoushe
casualquickmiddle-easternvegetariancrispymeltyfluffyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 1.5 cups flour, 0.75 cup yogurt, and 0.5 teaspoon baking powder into a large bowl.

  2. Step 2

    Stir with a wooden spoon for 2 minutes until shaggy dough forms with no dry flour streaks visible at the bottom of the bowl.

  3. Step 3

    Knead the dough inside the bowl with your hands, pressing and folding for 1 minute until smooth and slightly sticky to the touch.

  4. Step 4

    Divide the dough into 2 equal pieces and shape each into a ball by pinching the bottom and rolling under your palm.

  5. Step 5

    Mix 1 cup shredded cheese and 3 tablespoons chopped mint in a small bowl until evenly combined.

  6. Step 6

    Heat a 12-inch nonstick skillet or cast iron pan over medium-high heat until oil placed in the center shimmers and slides quickly, about 90 seconds.

  7. Step 7

    Place one dough ball on a lightly oiled work surface and, using your fingertips, press and stretch it into a thin circle about 7 inches across and 1/8 inch thick.

  8. Step 8

    Slide the stretched dough into the hot skillet and cook for 2 minutes without moving it until the bottom turns golden brown and you smell a toasted aroma.

  9. Step 9

    Flip the dough using a flat spatula, then immediately sprinkle half of the cheese-mint filling evenly over the surface.

  10. Step 10

    Cook for 1.5 minutes until the bottom is golden and the cheese is beginning to melt, then transfer to a plate.

  11. Step 11

    Repeat steps 7–10 with the second dough ball and remaining filling.

  12. Step 12

    Cut each manoushe in half and serve warm while the cheese is still melted.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • small mixing bowl
  • 12-inch nonstick skillet or cast iron pan
  • flat spatula
  • work surface
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.