Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Leche Frita

Crispy fried milk custard squares dusted with cinnamon and sugar—a beloved Spanish dessert with a creamy inside and golden-brown exterior. Ready in under 25 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
3g
Leche Frita
indulgentcomfortspanishvegetariancrispycreamydessertweekend

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour 2 cups of milk into a medium saucepan. Add 0.5 cup of sugar and 0.25 teaspoon of salt. Stir with a whisk until the sugar dissolves, about 1 minute.

  2. Step 2

    Pour 0.5 cup of cornstarch into a small bowl. Slowly add 0.5 cup of cold milk to the cornstarch, stirring with a whisk until no lumps remain—the mixture should look like smooth, thick cream.

  3. Step 3

    Place the saucepan over medium heat and bring the milk to a simmer, stirring often, until tiny bubbles form around the edges and steam rises from the surface, about 5 minutes.

  4. Step 4

    Slowly pour the cornstarch mixture into the hot milk while whisking constantly to prevent lumps. Keep whisking for 2 minutes until the mixture thickens and looks like pudding.

  5. Step 5

    Remove the saucepan from heat. Pour the custard onto a parchment-lined baking sheet, spreading it with a rubber spatula into an even layer about 0.5 inch thick. Let it cool for 15 minutes until it firms up.

  6. Step 6

    Once the custard has cooled and is firm to the touch, use a knife to cut it into 2-inch-by-2-inch squares. A bench scraper or thin spatula helps lift each square without breaking.

  7. Step 7

    Pour 2 cups of olive oil into a large skillet or deep saucepan. Heat over medium-high heat until the oil shimmers and a wooden spoon handle dipped in it shows tiny, rapid bubbles, about 3 minutes.

  8. Step 8

    Working carefully, slide 3 or 4 custard squares into the hot oil using a slotted spoon or thin spatula. Fry for 1 to 2 minutes on the first side until the surface turns golden brown and looks like caramel.

  9. Step 9

    Flip each square gently with a slotted spoon or spatula. Fry the other side for 1 to 2 minutes until it also turns golden brown. Transfer the fried squares to a plate lined with paper towels.

  10. Step 10

    Repeat with remaining custard squares, working in batches so the oil stays hot. You should have 8 to 10 golden squares total.

  11. Step 11

    Mix 1 teaspoon of cinnamon with 2 tablespoons of sugar in a small bowl, stirring with a spoon until well combined.

  12. Step 12

    Sprinkle the cinnamon-sugar mixture generously over all the warm fried custard squares while they are still hot—the sugar will stick to the crispy surface. Serve immediately.

Tools you’ll need

  • medium saucepan
  • small bowl
  • whisk
  • rubber spatula
  • parchment paper
  • baking sheet
  • knife or bench scraper
  • large skillet or deep saucepan
  • slotted spoon or thin spatula
  • paper towels
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.