Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Lemon Butter Beef Piccata

Thin-pounded beef cutlets seared golden, finished with a bright lemon-caper pan sauce. Restaurant-quality weeknight dinner in 20 minutes.

Total time
20 min
Servings
2
Calories
380
Protein
32g
Lemon Butter Beef Piccata
elegantquickitalianbeeftendercrispyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place each beef cutlet between plastic wrap and pound to 1/4-inch thickness with a meat mallet.

  2. Step 2

    Season beef with salt and pepper. Dredge lightly in flour, shaking off excess.

  3. Step 3

    Heat 1 tbsp butter and 1 tbsp olive oil in a 12-inch skillet over medium-high until foaming.

  4. Step 4

    Sear beef 90 seconds per side without moving until golden. Transfer to a plate.

  5. Step 5

    Pour wine into the pan, scraping up browned bits. Add lemon juice, capers, and remaining 2 tbsp butter.

  6. Step 6

    Simmer 1 minute until sauce thickens slightly. Return beef to pan, coat with sauce, and serve immediately.

Tools you’ll need

  • 12-inch skillet
  • meat mallet
  • plastic wrap
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.