CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Lemon Chickpea Soup

Greek revithosoupa stripped down to its bright essence: chickpeas, lemon, and olive oil simmered into a warm, tangy bowl in 20 minutes. Serve with crusty bread.

Total time
20 min
Servings
4
Calories
245
Protein
9g
20-Min Lemon Chickpea Soup
comfortwholesomegreekvegetarianvegandairy-freechickpeascreamy

Ingredients

  • 3 tbsp olive oil
  • 1 medium yellow onion, diced
  • 3 cloves garlic, minced
  • 2 cans (15 oz each) canned chickpeas, drained and rinsed
  • 4 cups vegetable broth
  • 2 medium lemon (juiced)

Instructions

  1. 1

    Heat olive oil in a large pot over medium heat until shimmering, about 90 seconds.

  2. 2

    Add diced onion and cook, stirring occasionally, until softened and translucent, 4–5 minutes.

  3. 3

    Add garlic and cook until fragrant, 30 seconds—don't let it burn.

  4. 4

    Pour in broth and add chickpeas. Bring to a simmer and cook uncovered for 10 minutes.

  5. 5

    Squeeze in lemon juice. Taste and adjust salt, pepper, and lemon to your liking.

  6. 6

    Serve hot. Drizzle each bowl with a little extra olive oil if desired.

Tools you’ll need

  • large pot (5-quart)
  • wooden spoon
  • can opener

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.