Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Lemon Chickpea Soup

Greek revithosoupa stripped down to its bright essence: chickpeas, lemon, and olive oil simmered into a warm, tangy bowl in 20 minutes. Serve with crusty bread.

Total time
20 min
Servings
4
Calories
245
Protein
9g
20-Min Lemon Chickpea Soup
comfortwholesomegreekvegetarianvegandairy-freechickpeascreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat olive oil in a large pot over medium heat until shimmering, about 90 seconds.

  2. Step 2

    Add diced onion and cook, stirring occasionally, until softened and translucent, 4–5 minutes.

  3. Step 3

    Add garlic and cook until fragrant, 30 seconds—don't let it burn.

  4. Step 4

    Pour in broth and add chickpeas. Bring to a simmer and cook uncovered for 10 minutes.

  5. Step 5

    Squeeze in lemon juice. Taste and adjust salt, pepper, and lemon to your liking.

  6. Step 6

    Serve hot. Drizzle each bowl with a little extra olive oil if desired.

Tools you’ll need

  • large pot (5-quart)
  • wooden spoon
  • can opener

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.