CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Loaded Chili Cheese Dogs

Hot dogs topped with warm canned chili and melted cheddar cheese, ready in under 10 minutes. A classic American weeknight dinner that tastes indulgent but requires zero cooking skill.

Total time
8 min
Servings
4
Calories
520
Protein
22g
Loaded Chili Cheese Dogs
comfortcasualamericanbeefcrispymeltyweeknightsandwich

Ingredients

  • 4 count hot dogs
  • 4 count hot dog buns
  • 1 can (15 oz) canned chili
  • ¾ cup cheddar cheese, shredded

Instructions

  1. 1

    Heat a skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Sear hot dogs 90 seconds per side without moving until browned and heated through.

  3. 3

    Toast the buns in the same skillet 30 seconds per side until light golden.

  4. 4

    Warm the canned chili in a small pot over medium heat, stirring occasionally, ~3 minutes.

  5. 5

    Nestle each hot dog into a bun, then top generously with warm chili and shredded cheddar.

  6. 6

    Serve immediately while cheese is still melty.

Tools you’ll need

  • 12-inch skillet
  • small pot
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.