Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Loaded Chili Cheese Dogs

Hot dogs topped with warm canned chili and melted cheddar cheese, ready in under 10 minutes. A classic American weeknight dinner that tastes indulgent but requires zero cooking skill.

Total time
8 min
Servings
4
Calories
520
Protein
22g
Loaded Chili Cheese Dogs
comfortcasualamericanbeefcrispymeltyweeknightsandwich

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Sear hot dogs 90 seconds per side without moving until browned and heated through.

  3. Step 3

    Toast the buns in the same skillet 30 seconds per side until light golden.

  4. Step 4

    Warm the canned chili in a small pot over medium heat, stirring occasionally, ~3 minutes.

  5. Step 5

    Nestle each hot dog into a bun, then top generously with warm chili and shredded cheddar.

  6. Step 6

    Serve immediately while cheese is still melty.

Tools you’ll need

  • 12-inch skillet
  • small pot
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.