Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Matoke Bowl with Tomato Stew

Soft, buttery plantain mash loaded with a fragrant, quick tomato and onion stew. This is the TikTok-easy version of Kenya's beloved comfort dish — no long simmering, just 20 minutes to a complete dinner.

Total time
20 min
Servings
2
Calories
340
Protein
3g
20-Min Matoke Bowl with Tomato Stew
comfortwholesomekenyanveganvegetariandairy-freevegansoft

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel plantains and cut into 2-inch chunks. Boil in salted water until tender, about 10 minutes.

  2. Step 2

    While plantains cook, heat oil in a skillet over medium. Dice the onion and sauté until translucent, 2 minutes.

  3. Step 3

    Mince garlic and add to the onion, stirring for 30 seconds until fragrant.

  4. Step 4

    Pour in tomatoes and broth. Simmer 5 minutes, stirring occasionally, until stew thickens slightly.

  5. Step 5

    Drain plantains and return to the pot they cooked in. Mash roughly with a fork until chunky-smooth.

  6. Step 6

    Divide matoke between bowls, top with tomato stew, and scatter cilantro over the top.

Tools you’ll need

  • large pot for boiling plantains
  • 10-inch skillet
  • wooden spoon for mashing
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.