CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Matoke Bowl with Tomato Stew

Soft, buttery plantain mash loaded with a fragrant, quick tomato and onion stew. This is the TikTok-easy version of Kenya's beloved comfort dish — no long simmering, just 20 minutes to a complete dinner.

Total time
20 min
Servings
2
Calories
340
Protein
3g
20-Min Matoke Bowl with Tomato Stew
comfortwholesomekenyanveganvegetariandairy-freevegansoft

Ingredients

  • 4 medium plantains, green or semi-ripe
  • 1 medium yellow onion
  • 14 oz tomatoes, fresh or canned
  • 1 cup vegetable broth
  • 3 cloves garlic cloves
  • 2 tbsp coconut oil or olive oil
  • ¼ cup fresh cilantro or parsley, chopped

Instructions

  1. 1

    Peel plantains and cut into 2-inch chunks. Boil in salted water until tender, about 10 minutes.

  2. 2

    While plantains cook, heat oil in a skillet over medium. Dice the onion and sauté until translucent, 2 minutes.

  3. 3

    Mince garlic and add to the onion, stirring for 30 seconds until fragrant.

  4. 4

    Pour in tomatoes and broth. Simmer 5 minutes, stirring occasionally, until stew thickens slightly.

  5. 5

    Drain plantains and return to the pot they cooked in. Mash roughly with a fork until chunky-smooth.

  6. 6

    Divide matoke between bowls, top with tomato stew, and scatter cilantro over the top.

Tools you’ll need

  • large pot for boiling plantains
  • 10-inch skillet
  • wooden spoon for mashing
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.