Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mediterranean Bowl

Warm grain bowl with roasted vegetables, chickpeas, and a bright lemon-tahini dressing. Ready in 25 minutes and fully customizable with pantry staples.

Total time
25 min
Servings
2
Calories
385
Protein
13g
Mediterranean Bowl
freshwholesomesimplemediterraneanvegetarianveganchickpeascrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve the cherry tomatoes. Slice the cucumber into thin rounds. Dice the red onion finely.

  2. Step 2

    Pat the chickpeas dry with a kitchen towel. Toss with 1 tbsp olive oil, salt, and pepper.

  3. Step 3

    Spread chickpeas on a sheet pan. Roast at 425°F until crispy and browned, ~12 minutes.

  4. Step 4

    While chickpeas roast, whisk tahini with lemon juice, 2 tbsp water, salt, and pepper until smooth.

  5. Step 5

    Divide quinoa between two bowls. Top with roasted chickpeas, tomatoes, cucumber, and red onion.

  6. Step 6

    Drizzle tahini dressing over the bowl. Serve immediately.

Tools you’ll need

  • sheet pan
  • kitchen towel
  • small bowl
  • whisk
  • two serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.