Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Melty Bean & Cheese Molletes

Split French bread, top with warm refried beans and melted Monterey Jack, then broil until bubbly and golden. A 10-minute breakfast that tastes like a Mexican bakery.

Total time
10 min
Servings
2
Calories
385
Protein
16g
Melty Bean & Cheese Molletes
quickcomfortmexicanvegetariancrispymeltyweeknightbreakfast

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the loaf in half lengthwise, then place both halves cut-side up on a broiler pan.

  2. Step 2

    Spread refried beans evenly over both halves, using about 1/2 cup per half.

  3. Step 3

    Top each half with shredded Monterey Jack cheese, pressing gently to stick.

  4. Step 4

    Broil 3-4 inches from heat until cheese melts and bubbles, about 3-4 minutes.

  5. Step 5

    Cool 1 minute, then slice each half into 2-3 pieces and serve immediately.

Tools you’ll need

  • broiler pan
  • bread knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.