Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Mug Tiramisu

Individual tiramisu made in a mug—no baking required. Layers of coffee-soaked ladyfingers, creamy mascarpone, and cocoa powder are ready in minutes.

Total time
15 min
Servings
2
Calories
285
Protein
5g
Mug Tiramisu
indulgentsimpleitalianvegetariancreamyfluffysoftdessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pour the cooled coffee into a shallow dish about the size of a cereal bowl.

  2. Step 2

    Place the mascarpone, sugar, and vanilla extract in a small bowl and whisk together until the mixture looks pale and fluffy, about 1 minute.

  3. Step 3

    Quickly dip one ladyfinger into the coffee dish for exactly 1 second on each side—it should feel soft but not falling apart—and place it in the bottom of the first mug.

  4. Step 4

    Repeat dipping and place a second soaked ladyfinger on top of the first one in the same mug.

  5. Step 5

    Spoon half of the mascarpone mixture on top of the ladyfingers in the first mug, spreading it gently into an even layer.

  6. Step 6

    Repeat steps 3–5 with the second mug using 2 more dipped ladyfingers and the remaining mascarpone mixture.

  7. Step 7

    Use a fine-mesh sieve or fine sifter to dust the top of each mug evenly with cocoa powder until you can no longer see the mascarpone layer beneath.

  8. Step 8

    Serve immediately, or cover and refrigerate for up to 4 hours before serving.

Tools you’ll need

  • 2 mugs (8–12 oz capacity)
  • shallow dish or saucer
  • small bowl
  • whisk
  • small spoon
  • fine-mesh sieve or fine sifter

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.